GPX4 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GPX4 |
GPX4 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GPX4 |
RRM2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RRM2 |
Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LAP3 antibody: synthetic peptide directed towards the N terminal of human LAP3. Synthetic peptide located within the following region: LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN |
Rabbit Polyclonal GCLM Antibody
Applications | ELISA, WB |
Reactivities | Human, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal GSTP1 Antibody (C-term)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GSTP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 165-192 amino acids from the C-terminal region of human GSTP1. |
Rabbit polyclonal GSTM1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This GSTM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 184-211 amino acids from the C-terminal region of human GSTM1. |
Goat Polyclonal Antibody against GPX1
Applications | IHC, WB |
Reactivities | Human, Pig |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-REALPAPSDDATA, from the internal region of the protein sequence according to NP_000572.2. |
Goat Polyclonal Antibody against GPX4
Applications | IHC, WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EEPLVIEKDLPHY, from the C Terminus of the protein sequence according to NP_002076.2; NP_001034937.1. |
Rabbit Polyclonal Anti-GCLM Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GCLM antibody: synthetic peptide directed towards the middle region of human GCLM. Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ |
Rabbit Polyclonal Anti-GPX4 Antibody - middle region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4. Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA |
Rabbit polyclonal antibody to Glutathione Peroxidase 2 (glutathione peroxidase 2 (gastrointestinal))
Applications | IHC, WB |
Reactivities | Human (Predicted: Dog, Pig, Rabbit, Chimpanzee, Bovine, Rhesus Monkey, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 54 of GPX2 |
RRM1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RRM1 |
Rabbit polyclonal antibody to Glutathione peroxidase 7 (glutathione peroxidase 7)
Applications | IHC, WB |
Reactivities | Human (Predicted: Chimpanzee) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 187 of GPX7 (Uniprot ID#Q96SL4) |
Rabbit Polyclonal antibody to GSTO1 (glutathione S-transferase omega 1)
Applications | IHC, WB |
Reactivities | Human (Predicted: Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 30 and 241 of GSTO1 (Uniprot ID#P78417) |
Rabbit anti-GCLM Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GCLM |