Antibodies

Jump to Filters
View as table Download
Rad51L1 (RAD51B) Rabbit Polyclonal Antibody
TA312603

USD 380.00

In Stock

Rabbit polyclonal anti-RAD51L1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD51L1.
Rad51L1 (RAD51B) Rabbit Polyclonal Antibody
AP20559PU-N

USD 465.00

3 Weeks

Rad51L1 (RAD51B) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 201-250 of Human Rad51B.
Rad51L1 (RAD51B) Rabbit Polyclonal Antibody
TA344637

USD 539.00

5 Days

Rabbit Polyclonal Anti-RAD51L1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD51L1 antibody: synthetic peptide directed towards the middle region of human RAD51L1. Synthetic peptide located within the following region: TESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRI
Rad51L1 (RAD51B) Rabbit Polyclonal Antibody
TA344636

USD 539.00

5 Days

Rabbit Polyclonal Anti-RAD51L1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD51L1 antibody: synthetic peptide directed towards the middle region of human RAD51L1. Synthetic peptide located within the following region: IPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTW
Rad51L1 (RAD51B) Rabbit Polyclonal Antibody
TA362659

USD 539.00

5 Days

RAD51B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RAD51L1