Antibodies

Jump to Filters
View as table Download
SV2A Rabbit Polyclonal Antibody
TA322365

USD 380.00

4 Weeks

Anti-SV2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 21-35 amino acids of human synaptic vesicle glycoprotein 2A
Sv2a Goat Polyclonal Antibody
TA303147

USD 520.00

5 Days

Goat Polyclonal Antibody against SV2A

Applications WB
Reactivities Rat (Expected from sequence similarity: Human, Mouse, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-TVELYPSDKRTTA, from the internal region of the protein sequence according to NP_055664.2.
SV2A Rabbit Polyclonal Antibody
TA341964

USD 539.00

5 Days

Rabbit Polyclonal Anti-SV2A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SV2A antibody: synthetic peptide directed towards the middle region of human SV2A. Synthetic peptide located within the following region: LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT
SV2A Rabbit Polyclonal Antibody
TA382223

USD 365.00

3 Weeks

SV2A Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 356-447 of human SV2A (NP_055664.3).
Modifications Unmodified