Antibodies

Jump to Filters
View as table Download
NAT1 Rabbit Polyclonal Antibody
TA590782

USD 482.00

In Stock

Rabbit Polyclonal NAT1 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
Cytochrome P450 1A2 (CYP1A2) Rabbit Polyclonal Antibody
TA313311

USD 380.00

In Stock

Rabbit polyclonal Cytochrome P450 1A2 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A2.
Xanthine Oxidase (XDH) Guinea Pig Polyclonal Antibody
AP09533SU-N

USD 490.00

2 Weeks

Xanthine Oxidase (XDH) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Xanthine Oxidase purified from Bovine Milk Fat Globule Membrane (MFGM).
Xanthine Oxidase (XDH) Rabbit Polyclonal Antibody
TA343291

USD 539.00

5 Days

Rabbit Polyclonal Anti-XDH Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Xdh antibody is: synthetic peptide directed towards the N-terminal region of Rat Xdh. Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS