Antibodies

View as table Download

Rabbit Polyclonal Anti-SCD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCD antibody: synthetic peptide directed towards the middle region of human SCD. Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG

Rabbit Polyclonal SCD Antibody

Applications ICC/IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 50-100). [Swiss-Prot# O00767]

SCD1 (SCD) (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, FC, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RIKRTGDGNYKSG, from the C Terminus of the protein sequence according to NP_005054.3.