Antibodies

Jump to Filters
View as table Download
Lysyl tRNA synthetase (KARS) Rabbit Polyclonal Antibody
TA350109

USD 380.00

In Stock

Rabbit Polyclonal Anti-KARS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KARS
Lysyl tRNA synthetase (KARS) (N-term) Rabbit Polyclonal Antibody
AP52290PU-N

USD 580.00

2 Weeks

Lysyl tRNA synthetase (KARS) (N-term) rabbit polyclonal antibody, Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 77-105 amino acids from the N-terminal region of human KARS
Lysyl tRNA synthetase (KARS) Rabbit Polyclonal Antibody
TA345923

USD 539.00

5 Days

Rabbit Polyclonal Anti-KARS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KARS antibody: synthetic peptide directed towards the C terminal of human KARS. Synthetic peptide located within the following region: GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV