Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal c-Myc Antibody
| Applications | ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106] |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Chicken, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit Polyclonal antibody to NLK (nemo-like kinase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 234 and 527 of NLK (Uniprot ID#Q9UBE8) |
Rabbit polyclonal SMAD4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 400-428 amino acids from the C-terminal region of human SMAD4. |
PPAR delta (PPARD) (430-441) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from the C-terminus of human PPARD |
Anti-NFATC2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2-15 amino acids of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 |
Rabbit Polyclonal Anti-NFATC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI |
Active filters
Category
- Antibodies
Reactivities
- Mouse
Clonalities
- Polyclonal
Families
- Transcription Factors
Pathways
- Wnt signaling pathway
Filter by
Target Symbol
- BETA CATENIN (29)
- C-JUN (22)
- P53 (21)
- SMAD2 (18)
- C-MYC (17)
- SMAD3 (17)
- PP2A-ALPHA (8)
- NFATC4 (7)
- PPP2R1A (7)
- SMAD4 (7)
- NFAT1 (6)
- EP300 (4)
- NFAT4 (4)
- LEF1 (3)
- NFAT2 (3)
- PPAR DELTA (3)
- PPP2R1B (3)
- FRA1 (2)
- NLK (2)
- PPP3CB (2)
- TBL1 (2)
- TBLR1 (2)
- TCF7 (2)
- CTNNBIP1 (1)
- NFAT5 (1)
- SOX17 (1)
- TCF7L1 (1)
- TCF7L2 (1)
- TIP49A (1)