Antibodies

View as table Download

beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1.

Goat Polyclonal Anti-beta-Catenin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.

Rabbit polyclonal MITF (Ab-180/73) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M).

Anti-MITF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 173 amino acids of human matrix metallopeptidase 28

Rabbit Polyclonal Anti-CREB3L2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CREB3L2 antibody: synthetic peptide directed towards the N terminal of human CREB3L2. Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF

Anti-CREB1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 12-341 amino acids of human cAMP responsive element binding protein 1

Rabbit Polyclonal Anti-EP300 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EP300

Rabbit Polyclonal Anti-TCF7L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN

MITF (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 8-36 amino acids from the N-terminal region of Human MITF.

Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133.
Modifications Phospho-specific

Rabbit Polyclonal Anti-CTNNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP

Rabbit Polyclonal Anti-CTNNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG

Rabbit Polyclonal Anti-TCF7L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the middle region of human TCF7L2. Synthetic peptide located within the following region: GGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQES

CREB3L1 (C-term) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 488~517 amino acids from the C-terminal region of Human CREB3L1

Rabbit polyclonal anti-p300 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human p300.