Antibodies

View as table Download

Rabbit Polyclonal Anti-CBX3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CBX3

Rabbit Polyclonal Anti-CBX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBX3 antibody: synthetic peptide directed towards the middle region of human CBX3. Synthetic peptide located within the following region: ELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARG

Rabbit polyclonal CBX3 / HP1 gamma (Ser93) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human HP1? around the phosphorylation site of serine 93 (R-K-SP-L-S).
Modifications Phospho-specific

Goat Polyclonal Antibody against CBX3 / HP1 Gamma

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EAFLNSQKAGKEKD, from the internal region of the protein sequence according to NP_009207.2; NP_057671.2.

Rabbit polyclonal CBX3 / HP1 gamma (Ab-93) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human HP1? around the phosphorylation site of serine 93 (R-K-SP-L-S).

Rabbit Polyclonal Anti-CBX3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBX3 antibody: synthetic peptide directed towards the middle region of human CBX3. Synthetic peptide located within the following region: WEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDA