Rabbit Polyclonal Anti-CBX3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CBX3 |
Rabbit Polyclonal Anti-CBX3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CBX3 |
Rabbit Polyclonal Anti-CBX3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CBX3 antibody: synthetic peptide directed towards the middle region of human CBX3. Synthetic peptide located within the following region: ELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARG |
Rabbit polyclonal CBX3 / HP1 gamma (Ser93) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HP1? around the phosphorylation site of serine 93 (R-K-SP-L-S). |
Modifications | Phospho-specific |
Goat Polyclonal Antibody against CBX3 / HP1 Gamma
Applications | WB |
Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EAFLNSQKAGKEKD, from the internal region of the protein sequence according to NP_009207.2; NP_057671.2. |
Rabbit polyclonal CBX3 / HP1 gamma (Ab-93) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HP1? around the phosphorylation site of serine 93 (R-K-SP-L-S). |
Rabbit Polyclonal Anti-CBX3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CBX3 antibody: synthetic peptide directed towards the middle region of human CBX3. Synthetic peptide located within the following region: WEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDA |