Antibodies

Jump to Filters
View as table Download
Nav1.6 (SCN8A) Rabbit Polyclonal Antibody
TA355747

USD 539.00

5 Days

SCN8A Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human SCN8A
Nav1.6 (SCN8A) Rabbit Polyclonal Antibody
TA338572

USD 539.00

5 Days

Rabbit Polyclonal Anti-SCN8A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN8A antibody: synthetic peptide directed towards the middle region of human SCN8A. Synthetic peptide located within the following region: ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC