Antibodies

Jump to Filters
View as table Download
KCNK15 Rabbit Polyclonal Antibody
TA315706

USD 380.00

4 Weeks

Rabbit polyclonal anti-KCNK15 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human KCNK15.
KCNK15 Rabbit Polyclonal Antibody
TA338709

USD 539.00

5 Days

Rabbit Polyclonal Anti-KCNK15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNK15 antibody: synthetic peptide directed towards the middle region of human KCNK15. Synthetic peptide located within the following region: ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSI