Antibodies

View as table Download

Rabbit Polyclonal Anti-KCNA7 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNA7

Rabbit Polyclonal Anti-KCNA7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNA7 antibody: synthetic peptide directed towards the C terminal of human KCNA7. Synthetic peptide located within the following region: GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV