Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the N terminal of human KCNQ2. Synthetic peptide located within the following region: YRGWRGRLKFARKPFCVIDIMVLIASIAVLAAGSQGNVFATSALRSLRFL |
Rabbit Polyclonal Anti-KCND3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCND3 antibody: synthetic peptide directed towards the middle region of human KCND3. Synthetic peptide located within the following region: VAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLH |
Rabbit Polyclonal Anti-KCNG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNG1 antibody: synthetic peptide directed towards the N terminal of human KCNG1. Synthetic peptide located within the following region: YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIA |
Rabbit Polyclonal Anti-KCNG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNG1 antibody: synthetic peptide directed towards the N terminal of human KCNG1. Synthetic peptide located within the following region: MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD |
Rabbit Polyclonal Anti-KCNG4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNG4 antibody: synthetic peptide directed towards the N terminal of human KCNG4. Synthetic peptide located within the following region: QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRP |
Rabbit Polyclonal Anti-Kcng4 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Kcng4 antibody is: synthetic peptide directed towards the middle region of RAT Kcng4. Synthetic peptide located within the following region: SDESPEAGERPSGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGL |
Rabbit Polyclonal Anti-KCNC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNC1 antibody: synthetic peptide directed towards the N terminal of human KCNC1. Synthetic peptide located within the following region: TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY |
Rabbit Polyclonal Anti-KCNK6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNK6 antibody: synthetic peptide directed towards the n terminal of human KCNK6. Synthetic peptide located within the following region: RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK |
Rabbit Polyclonal Anti-KCNK4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNK4 antibody: synthetic peptide directed towards the N terminal of human KCNK4. Synthetic peptide located within the following region: ELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSA |
Rabbit Polyclonal Anti-KCNC2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNC2 Antibody: A synthesized peptide derived from human KCNC2 |
Rabbit polyclonal Kv2.1 (Ser805) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Kv2.1 around the phosphorylation site of serine 805 (P-T-SP-P-K). |
| Modifications | Phospho-specific |
Kv1.6 (KCNA6) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from the Rat Kv1.6 potassium channel conjugated to KLH |
Germany
Japan
United Kingdom
China