Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal anti-GNAS antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
| Applications | IF, WB |
| Reactivities | Human, Mouse (Predicted: Pig) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human (Predicted: Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Gibbon, Mouse, Panda (90%); Rat, Bovine, Elephant, Rabbit, Pig (85%). |
Rabbit Polyclonal Anti-PTGER3 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | PTGER3 / EP3 antibody was raised against synthetic 17 amino acid peptide from 1st cytoplasmic domain of human PTGER3 / EP3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda, Bat (100%); Mouse (94%); Xenopus (88%); Bovine, Pig, Opossum (82%). |
Rabbit Polyclonal Anti-ADRB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS |
Goat Polyclonal Antibody against CCKBR
| Applications | IHC, WB |
| Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-FDGDSDSDSQSRVRNQ, from the internal region of the protein sequence according to NP_795344.1. |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
