Antibodies

View as table Download

Rabbit polyclonal anti-HTR5A antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HTR5A.

5HT5A receptor (HTR5A) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids N-terminus of Human SR-5A.

Rabbit polyclonal anti-5-HT-5A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-5A.

Rabbit Polyclonal Anti-HTR5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR5A antibody: synthetic peptide directed towards the N terminal of human HTR5A. Synthetic peptide located within the following region: DLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLV

5HT5A receptor (HTR5A) rabbit polyclonal antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-HTR5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HTR5A Antibody: synthetic peptide directed towards the N terminal of human HTR5A. Synthetic peptide located within the following region: MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFL

Rabbit Polyclonal Anti-5-HT-5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-5-HT-5A Antibody: A synthesized peptide derived from human 5-HT-5A