Antibodies

View as table Download

Rabbit Polyclonal Anti-CACNB2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CACNB2

CACNB2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 481-660 of human CACNB2 (NP_963890.2).
Modifications Unmodified

CACNB2 rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the rat beta2 calcium channel conjugated to KLH.

Goat Anti-CACNB2 (aa565-579) Antibody

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence ECNKQRSRHKSKDRY, from the C Terminus of the protein sequence according to NP_000715.2; NP_963890.2; NP_963884.2; NP_963891.1; NP_963887.2; NP_963865.2; NP_963864.1; NP_963866.2; NP_001161417.1.

Rabbit Polyclonal Anti-CaVBeta2

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HEHVDRYVPHREHNHRE, corresponding to amino acid residues 571-587 of rat CavÃ?2. Intracellular, C-terminus.

Rabbit Polyclonal Anti-Cacnb2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cacnb2 antibody is: synthetic peptide directed towards the middle region of Rat Cacnb2. Synthetic peptide located within the following region: DFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQ