Antibodies

Jump to Filters
View as table Download
Prickle 2 (PRICKLE2) Rabbit Polyclonal Antibody
TA320126

USD 570.00

2 Weeks

Rabbit Polyclonal PRICKLE2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PRICKLE2 antibody was raised against a 15 amino acid synthetic peptide near the center of human PRICKLE2.
Prickle 2 (PRICKLE2) Rabbit Polyclonal Antibody
TA337710

USD 539.00

5 Days

Rabbit Polyclonal Anti-PRICKLE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRICKLE2 antibody is: synthetic peptide directed towards the C-terminal region of Human PRICKLE2. Synthetic peptide located within the following region: IPQPARLRYVTSDELLHKYSSYGLPKSSTLGGRGQLHSRKRQKSKNCIIS