Antibodies

Jump to Filters
View as table Download
IL20RB Rabbit Polyclonal Antibody
TA315508

USD 380.00

2 Weeks

Rabbit polyclonal anti-IL20RB antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IL20RB.
IL20RB Rabbit Polyclonal Antibody
TA343042

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL20RB Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Il20rb antibody is: synthetic peptide directed towards the middle region of Mouse Il20rb. Synthetic peptide located within the following region: LEDLGPQFEFLVVYWRREPGAAEHVKMVRSGDIPVHLETMEPGAMYCVKA