Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-DGAT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KLEHPTQQDIDLYH, from the internal region (near the C Terminus) of the protein sequence according to NP_115953.2. |
Rabbit Polyclonal DGAT1 Antibody
| Applications | ICC/IF, Immunoblotting, WB |
| Reactivities | Bovine, Goat, Human, Mouse, Primate, Rat, Sheep, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide within an internal region (residues 200-300) of the human DGAT1 protein. [Swiss-Prot# O75907] |
Rabbit Polyclonal Anti-DGKE Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKE antibody: synthetic peptide directed towards the N terminal of human DGKE. Synthetic peptide located within the following region: EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR |
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
Goat Polyclonal Antibody against DGAT1
| Applications | WB |
| Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QNSMKPFKDMDYS, from the internal region of the protein sequence according to NP_036211.1. |
Rabbit polyclonal anti-DGKE antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKE. |
Rabbit Polyclonal Anti-AGPAT6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AGPAT6 |
Rabbit Polyclonal Anti-AGPAT6 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human AGPAT6 |
USD 580.00
5 Days
Phosphatidic acid phosphatase type 2B (PLPP3) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from the phosphatidic acid phosphatase 2B protein |
DGKE rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Glycerolipid metabolism