Rabbit Polyclonal Anti-DHCR24 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DHCR24 |
Rabbit Polyclonal Anti-DHCR24 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DHCR24 |
Rabbit Polyclonal Anti-TM7SF2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TM7SF2 |
Rabbit Polyclonal Anti-DHCR7 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DHCR7 |
Rabbit Polyclonal Anti-MSMO1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MSMO1 |
Rabbit Polyclonal Anti-SQLE Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SQLE antibody: synthetic peptide directed towards the C terminal of human SQLE. Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE |
Rabbit Polyclonal Anti-DHCR24 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DHCR24 antibody: synthetic peptide directed towards the N terminal of human DHCR24. Synthetic peptide located within the following region: FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK |
Rabbit Polyclonal Anti-CYP51A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP51A1 antibody: synthetic peptide directed towards the N terminal of human CYP51A1. Synthetic peptide located within the following region: TYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQ |
Rabbit Polyclonal Anti-SC5DL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SC5DL Antibody: synthetic peptide directed towards the N terminal of human SC5DL. Synthetic peptide located within the following region: NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV |
Rabbit Polyclonal Anti-EBP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EBP antibody: synthetic peptide directed towards the N terminal of human EBP. Synthetic peptide located within the following region: LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA |
Rabbit Polyclonal Anti-SC4MOL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SC4MOL antibody: synthetic peptide directed towards the N terminal of human SC4MOL. Synthetic peptide located within the following region: MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA |
Rabbit Polyclonal Anti-DHCR24 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DHCR24 antibody: synthetic peptide directed towards the middle region of human DHCR24. Synthetic peptide located within the following region: AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE |
Rabbit Polyclonal Anti-NSDHL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NSDHL antibody: synthetic peptide directed towards the middle region of human NSDHL. Synthetic peptide located within the following region: RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN |