Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal Anti-Mapk11 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Mapk11 antibody is: synthetic peptide directed towards the N-terminal region of Rat Mapk11. Synthetic peptide located within the following region: VPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTY |
Rabbit polyclonal MAP3K7 (Ser439) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Stathmin around the phosphorylation site of serine 439 (R-R-SP-I-Q). |
| Modifications | Phospho-specific |
Rabbit polyclonal p38 MAPK (Phospho-Thr180) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human P38 MAPK around the phosphorylation site of threonine 179 (E-M-TP-G-Y). |
| Modifications | Phospho-specific |
Rabbit Polyclonal IKK-beta Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK-beta |
Rabbit anti I-Kappa-B Kinase b (IKKb) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The full length of human IKKβ recombinant protein. |
Rabbit anti Mekk-1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti IKK-a (pS176/180) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding of –QGSLCTS-of human IKK-a/β protein with a single phosphorylation site. This sequence is identical to human, rat, mouse and bovine. |
Rabbit anti IKK-b (pY199) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti IKK-b (CT) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti IKK-a (Paired 176/180) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China