HES1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HES1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-HES1 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CTBP2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NUMB mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HDAC1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal TACE Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TACE antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human TACE This sequence differs from those of mouse and rat TACE by one amino acid. |
Anti-HES1 mouse mAb, clone OTI4H1, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) HES5 mouse monoclonal antibody,clone OTI6F7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal KAT3B/p300 Antibody (RW128)
Applications | FC, IP, WB |
Reactivities | Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734) |
DLL4 rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to the internal region of human DLL4. |
Rabbit Polyclonal Anti-DVL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DVL1 antibody: synthetic peptide directed towards the middle region of human DVL1. Synthetic peptide located within the following region: LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK |