Germany
Japan
United Kingdom
China
Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey, Dog |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit Polyclonal Anti-TUBB2A Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the N terminal of human TUBB2A. Synthetic peptide located within the following region: MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta (Ab-489) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
Mouse Monoclonal cleaved ROCK1 Antibody (154C1465)
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat, Canine, Primate, Rabbit |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-alpha-Tubulin Antibody [2B11]
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Rabbit, Zebrafish |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Actin-pan Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Actin-pan Antibody: A synthesized peptide derived from human Actin-pan |
Rabbit Polyclonal Anti-Claudin 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 1 Antibody: A synthesized peptide derived from human Claudin 1 |
Active filters
Category
- Antibodies
Reactivities
- Rat
Isotypes
- IgG
Pathways
- Pathogenic Escherichia coli infection
Citations
- Yes