Antibodies

View as table Download

LPL (Lipoprotein lipase) mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

ADIPOQ (Adiponectin) mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346)

CD36 mouse monoclonal antibody, clone OTI1B3 (formerly 1B3)

Applications FC
Reactivities Human, Rat
Conjugation Unconjugated

ADIPOQ (Adiponectin) mouse monoclonal antibody, clone OTI7B11 (formerly 7B11)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal Cytochrome P450 8B1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1.

Perilipin-1 (PLIN1) mouse monoclonal antibody, clone PERI112.17, Supernatant

Applications IF, IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated

ADIPOQ (Adiponectin) mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI

CYP27A1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 100-150 of Human CYP27A1.

Rabbit Polyclonal Anti-ACSL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI

Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4).

CD36 mouse monoclonal antibody, clone OTI1B3 (formerly 1B3)

Applications FC
Reactivities Human, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Mouse anti-SCD1 (Stearoyl-CoA desaturase) monoclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
TA309938 is a replacement of AM20836PU-N.