Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RXRA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
Rabbit Polyclonal NFkB1/NFkB p105 Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an N-terminal region of the human NFkB p105/p50 protein (within residues 400-590). [Swiss-Prot P19838] |
TNF mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
- Antibodies
Conjugates
- Unconjugated
Families
- Transcription Factors
Pathways
- Adipocytokine signaling pathway
Citations
- Yes