Antibodies

View as table Download

UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-UQCRC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV