USD 447.00
In Stock
UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
USD 447.00
In Stock
UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
USD 200.00
In Stock
UQCRC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-UQCRC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV |