Antibodies

Jump to Filters
View as table Download
Aquaporin 2 (AQP2) Rabbit Polyclonal Antibody
TA335241

USD 539.00

In Stock

Rabbit Polyclonal Anti-Aqp2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Aqp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLV
Aquaporin 2 (AQP2) Rabbit Polyclonal Antibody
TA323647

USD 380.00

In Stock

Anti-AQP2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-271 amino acids of Human Aquaporin-2
Aquaporin 2 (AQP2) Rabbit Polyclonal Antibody
TA323648

USD 380.00

In Stock

Anti-AQP2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-271 amino acids of Human Aquaporin-2