Rabbit Anti-NSE (Neuron specific enolase) Antibody
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant human NSE expressed in and purified from E. coli |
Rabbit Anti-NSE (Neuron specific enolase) Antibody
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant human NSE expressed in and purified from E. coli |
Rabbit Polyclonal Anti-ENO1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ENO1 |
Rabbit Polyclonal Anti-HSPA9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSPA9 |
Rabbit polyclonal anti-NSE / ENO2 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human NSE. |
Rabbit polyclonal anti-HSP60 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human HSP60. |
Rabbit polyclonal anti-HSPD1(HSP60) antibody(Center), Loading control
Applications | IF, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Hamster) |
Conjugation | Unconjugated |
Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-215 amino acids from the Central region of human HSPD1. |
Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)
Applications | IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat, Cow) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8) |
Rabbit Polyclonal Anti-RQCD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RQCD1 antibody is: synthetic peptide directed towards the middle region of Human RQCD1. Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK |
Rabbit anti-ENO1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ENO1 |
Rabbit Polyclonal NSE Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Anti-HSPD1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Anti-HSPD1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Anti-HSPD1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Anti-HSPD1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Goat Polyclonal Antibody against DEAD-box protein 6
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-AEYHSEPVEDEKP, from the C Terminus of the protein sequence according to NP_004388.1. |