Antibodies

Jump to Filters
View as table Download
PIWIL2 Rabbit Polyclonal Antibody
TA321862

USD 380.00

In Stock

Anti-PIWIL2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 107-120 amino acids of human piwi-like 2 (Drosophila)
PIWIL2 Rabbit Polyclonal Antibody
TA344930

USD 539.00

In Stock

Rabbit Polyclonal Anti-PIWIL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIWIL2 antibody: synthetic peptide directed towards the N terminal of human PIWIL2. Synthetic peptide located within the following region: QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM