Antibodies

Jump to Filters
View as table Download
NOTCH1 Rabbit Polyclonal Antibody
TA312382

USD 380.00

In Stock

Rabbit polyclonal Notch 1 (Cleaved-Val1744) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Notch 1.
BAX Rabbit Polyclonal Antibody
TA312600

USD 380.00

In Stock

Rabbit polyclonal anti-Bax antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Bax.
ELK1 Rabbit Polyclonal Antibody
TA313811

USD 380.00

In Stock

Rabbit polyclonal Elk-1(Ab-383) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human Elk-1 around the phosphorylation site of Serine 383.
PRKX Rabbit Polyclonal Antibody
TA314392

USD 380.00

In Stock

Rabbit polyclonal anti-PRKX antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRKX.
C1QA Rabbit Polyclonal Antibody
TA342833

USD 539.00

In Stock

Rabbit Polyclonal Anti-C1QA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1QA antibody: synthetic peptide directed towards the N terminal of human C1QA. Synthetic peptide located within the following region: PGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGG
CD56 (NCAM1) Rabbit Polyclonal Antibody
TA590358

USD 482.00

In Stock

Rabbit Polyclonal NCAM Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
HSP70-1A (HSPA1A) Rabbit Polyclonal Antibody
TA321706

USD 380.00

In Stock

Anti-HSPA1A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 531-641 amino acids of human heat shock 70kDa protein 1A
HSP70-1A (HSPA1A) Rabbit Polyclonal Antibody
TA321707

USD 380.00

In Stock

Anti-HSPA1A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 531-641 amino acids of human heat shock 70kDa protein 1A
FYN Rabbit Polyclonal Antibody
TA326081

USD 380.00

In Stock

Rabbit polyclonal Fyn (Ab-530) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Fyn around the phosphorylation site of tyrosine 530 (P-Q-YP-Q-P).
ERK2 (MAPK1) Rabbit Polyclonal Antibody
TA326202

USD 380.00

In Stock

Rabbit polyclonal MAPK1/3 (Ab-205/222) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human MAPK1.
MEK1 (MAP2K1) Rabbit Polyclonal Antibody
TA349388

USD 380.00

In Stock

Rabbit Polyclonal Anti-MAP2K1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAP2K1
PRKACG Rabbit Polyclonal Antibody
TA313080

USD 380.00

In Stock

Rabbit polyclonal anti-KAPCG antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human KAPCG.
FYN Rabbit Polyclonal Antibody
TA325489

USD 380.00

In Stock

Rabbit Polyclonal Fyn (Tyr530) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Fyn around the phosphorylation site of Tyrosine 530
Modifications Phospho-specific
ERK1 (MAPK3) Rabbit Polyclonal Antibody
TA325656

USD 380.00

In Stock

Rabbit Polyclonal ERK1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2
BAX Rabbit Polyclonal Antibody
TA312599

USD 380.00

In Stock

Rabbit polyclonal Bax (Thr167) antibody(Phospho-specific)

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Bax around the phosphorylation site of threonine 167 (F-G-TP-P-T).
Modifications Phospho-specific