Antibodies

Jump to Filters
View as table Download
NME6 Rabbit Polyclonal Antibody
TA322558

USD 380.00

In Stock

Anti-NME6 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
NME3 Rabbit Polyclonal Antibody
TA323000

USD 380.00

In Stock

Anti-NME3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
NME3 Rabbit Polyclonal Antibody
TA323001

USD 380.00

In Stock

Anti-NME3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
RRM1 Rabbit Polyclonal Antibody
TA323396

USD 380.00

In Stock

Anti-RRM1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 226 amino acids of human ribonucleotide reductase M1
Natriuretic Peptide Receptor A (NPR1) Rabbit Polyclonal Antibody
TA323534

USD 380.00

In Stock

Anti-NPR1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 525-541 amino acids of Human natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A)
RPC62 (POLR3C) Rabbit Polyclonal Antibody
TA326107

USD 380.00

In Stock

Rabbit polyclonal RPC3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPC3.
POLR1B Rabbit Polyclonal Antibody
TA346803

USD 539.00

In Stock

Rabbit Polyclonal Anti-POLR1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR1B antibody: synthetic peptide directed towards the middle region of human POLR1B. Synthetic peptide located within the following region: SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD
PRPS1 Rabbit Polyclonal Antibody
TA349256

USD 380.00

In Stock

Rabbit Polyclonal Anti-BACE1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human BACE1
AK3L1 (AK4) Mouse Monoclonal Antibody [Clone ID: OTI5B10]
TA502899S

USD 200.00

In Stock

AK4 mouse monoclonal antibody, clone OTI5B10 (formerly 5B10)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
POLR3GL Mouse Monoclonal Antibody [Clone ID: OTI5F10]
TA506864S

USD 200.00

In Stock

POLR3GL mouse monoclonal antibody, clone OTI5F10 (formerly 5F10)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated