TMX2 Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 128-296 of human TMX2 (NP_057043.1). |
TMX2 Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 128-296 of human TMX2 (NP_057043.1). |
Rabbit Polyclonal Anti-Tmx2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Tmx2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tmx2. Synthetic peptide located within the following region: IRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKHSKGGDMSEEKPV |
Rabbit Polyclonal Anti-TXNDC14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TXNDC14 antibody: synthetic peptide directed towards the middle region of human TXNDC14. Synthetic peptide located within the following region: IRMGLLYITLCIVFLMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWI |