Antibodies

View as table Download

Goat Polyclonal Anti-ZO1 Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.

Rabbit Polyclonal Anti-TJP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS

Rabbit polyclonal antibody to ZO-1 (tight junction protein 1 (zona occludens 1))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 296 of ZO-1 (Uniprot ID#Q07157)

TJP1 (alpha minus) guinea pig polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Human peptide antigen corresponding to ten residues at the splice junction.

Rabbit polyclonal antibody to ZO-1 (tight junction protein 1 (zona occludens 1))

Applications WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1574 and 1748 of ZO-1 (Uniprot ID#Q07157)

TJP1 (alpha plus) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Amino acids 886-995 of Human ZO-1

Rabbit Polyclonal Anti-ZO 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZO 1 Antibody: A synthesized peptide derived from human ZO 1

Tjp1 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated

ZO-1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1600-1700 of human ZO-1 (NP_003248.3).
Modifications Unmodified