Rabbit polyclonal anti-SYT16 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SYT16. |
Rabbit polyclonal anti-SYT16 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SYT16. |
Rabbit Polyclonal Anti-SYT16 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SYT16 antibody: synthetic peptide directed towards the N terminal of human SYT16. Synthetic peptide located within the following region: DKLDQDLDNIQIQETYFEDEEQDNDWSQEDANSLFLEVDHFSCCNSDLQD |