Antibodies

Jump to Filters
View as table Download
SEC14L4 Rabbit Polyclonal Antibody
TA333451

USD 539.00

5 Days

Rabbit Polyclonal Anti-SEC14L4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SEC14L4 Antibody: synthetic peptide directed towards the N terminal of human SEC14L4. Synthetic peptide located within the following region: MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ
SEC14L4 Rabbit Polyclonal Antibody
TA360503

USD 539.00

5 Days

SEC14L4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SEC14L4