Antibodies

View as table Download

Rabbit Polyclonal Anti-MAGEE1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAGEE1

Rabbit polyclonal anti-MAGEC2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MAGEC2.

Rabbit Polyclonal Anti-MAGEC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAGEC2 antibody: synthetic peptide directed towards the N terminal of human MAGEC2. Synthetic peptide located within the following region: SCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYTLDEKVAELVEF