Chicken Polyclonal ENC-2 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ENC-2 antibody was raised against a 14 amino acid peptide near the center of human ENC-2. |
Chicken Polyclonal ENC-2 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ENC-2 antibody was raised against a 14 amino acid peptide near the center of human ENC-2. |
Rabbit Polyclonal Anti-KLHL25 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLHL25 antibody: synthetic peptide directed towards the N terminal of human KLHL25. Synthetic peptide located within the following region: RLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFE |
KLHL25 mouse monoclonal antibody, clone 1B7, Ascites
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
KLHL25 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 61-91 amino acids from the N-terminal region of Human Kelch-like protein 25 |
Rabbit Polyclonal Anti-KLHL25 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-KLHL25 Antibody: synthetic peptide directed towards the N terminal of human KLHL25. Synthetic peptide located within the following region: SRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENA |
Rabbit Polyclonal Anti-KLHL25 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLHL25 antibody: synthetic peptide directed towards the N terminal of human KLHL25. Synthetic peptide located within the following region: LFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSEDFNSLSKDTL |