Antibodies

View as table Download

Carrier-free (BSA/glycerol-free) KLK2 mouse monoclonal antibody, clone OTI5D6 (formerly 5D6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Goat Polyclonal Antibody against KLK2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KHQSLRPDEDSSHD, from the internal region of the protein sequence according to NP_005542.1; NP_001002231.1.

Rabbit Polyclonal Anti-KLK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLK2 antibody: synthetic peptide directed towards the middle region of human KLK2. Synthetic peptide located within the following region: KHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASG