EIF4A3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human EIF4A3 |
EIF4A3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human EIF4A3 |
Rabbit Polyclonal Anti-EIF4A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EIF4A3 antibody: synthetic peptide directed towards the N terminal of human EIF4A3. Synthetic peptide located within the following region: RGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCL |
Rabbit Polyclonal Anti-DDX48 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DDX48 antibody: synthetic peptide directed towards the middle region of human DDX48. Synthetic peptide located within the following region: QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV |
eIF4A3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human eIF4A3 (NP_055555.1). |
Modifications | Unmodified |