Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-EIF4A3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF4A3 antibody: synthetic peptide directed towards the N terminal of human EIF4A3. Synthetic peptide located within the following region: RGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCL |
Rabbit Polyclonal Anti-DDX48 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX48 antibody: synthetic peptide directed towards the middle region of human DDX48. Synthetic peptide located within the following region: QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV |
eIF4A3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human eIF4A3 (NP_055555.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EIF4A3
Applications
- WB