Antibodies

Jump to Filters
View as table Download
EFCAB3 Rabbit Polyclonal Antibody
TA337784

USD 539.00

5 Days

Rabbit Polyclonal Anti-EFCAB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EFCAB3 antibody: synthetic peptide directed towards the N terminal of human EFCAB3. Synthetic peptide located within the following region: MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMA
EFCAB3 Rabbit Polyclonal Antibody
TA375731

USD 365.00

3 Weeks

EFCAB3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 249-438 of human EFCAB3 (NP_775774.1).
Modifications Unmodified