Antibodies

View as table Download

CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CLDN5 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal anti-Claudin 5 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CLDN5.

CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-Claudin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5

Rabbit Polyclonal Anti-CLDN5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN5 antibody: synthetic peptide directed towards the C terminal of human CLDN5. Synthetic peptide located within the following region: GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN

Rabbit Polyclonal Anti-Claudin 5 Antibody

Applications WB
Reactivities Mouse, Rat, Human, Pig, Cow
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5