Antibodies

Jump to Filters
View as table Download
CDH12 (N-term) Rabbit Polyclonal Antibody
AP11470PU-N

USD 580.00

2 Weeks

CDH12 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CDH12
CDH12 Rabbit Polyclonal Antibody
TA339392

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-CDH12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDH12 antibody: synthetic peptide directed towards the middle region of human CDH12. Synthetic peptide located within the following region: DTQEGVIKLKKPLDFETKKAYTFKVEASNLHLDHRFHSAGPFKDTATVKI