Antibodies

Jump to Filters
View as table Download
BRD7 Rabbit Polyclonal Antibody
TA343710

USD 539.00

5 Days

Rabbit Polyclonal Anti-BRD7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BRD7 antibody: synthetic peptide directed towards the C terminal of human BRD7. Synthetic peptide located within the following region: KELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDV
BRD7 Rabbit Polyclonal Antibody
TA374077

USD 450.00

3 Weeks

BRD7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human BRD7 (NP_037395.2).
Modifications Unmodified