Rabbit Polyclonal Anti-Qsox2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Qsox2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Qsox2. Synthetic peptide located within the following region: SWNEGQVLLFLKQHYSRDNLVDAYSVDQGSPGSVLRARPWLGQMARLSHV |
Rabbit Polyclonal Anti-QSOX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-QSOX2 antibody is: synthetic peptide directed towards the middle region of Human QSOX2. Synthetic peptide located within the following region: VVKPLRAFFSSYLKSLPDVRKKSLPLPEKPHKEENSEIVVWREFDKSKLY |
QSOX2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 370-650 of human QSOX2 (NP_859052.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China