PCNA mouse monoclonal antibody, clone PC10, Purified
Applications | IF, IHC, WB |
Reactivities | Human, Insect, Mouse, Rat, Yeast |
Conjugation | Unconjugated |
PCNA mouse monoclonal antibody, clone PC10, Purified
Applications | IF, IHC, WB |
Reactivities | Human, Insect, Mouse, Rat, Yeast |
Conjugation | Unconjugated |
PCNA mouse monoclonal antibody, clone PC10, Purified
Applications | IF, IHC, WB |
Reactivities | Human, Insect, Mouse, Rat, Yeast |
Conjugation | Unconjugated |
FH (176-189) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Canine, Human, Mouse, Rat, Bovine, Chicken, Drosophila, Equine, Hamster, Insect, Monkey, Porcine, Sheep, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from an internal region of human FH |
Rabbit Polyclonal Anti-GABARAP
Applications | WB |
Reactivities | Human, Insect, Cow, Dog, Mouse, Pig, Rabbit, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
Mitochondria mouse monoclonal antibody, clone MTC754, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Bacteria, Human, Insect |
Conjugation | Unconjugated |
Mitochondria mouse monoclonal antibody, clone MTC754, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Bacteria, Human, Insect |
Conjugation | Unconjugated |
ERK1 / ERK2 mouse monoclonal antibody, clone IL-13, Purified
Applications | IF, IHC, WB |
Reactivities | Human, Insect, Mouse, Rat, Yeast |
Conjugation | Unconjugated |