Germany
Japan
United Kingdom
China
Rabbit Polyclonal TLR2 Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | TLR2 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human TLR2. |
Antibodies
View as table DownloadRabbit Polyclonal anti-TLR2 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLR2 antibody: synthetic peptide directed towards the C terminal of human TLR2. Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS |
Mouse Monoclonal TLR2 Antibody (TL2.1)
| Applications | Block/Neutralize, Dot, ELISA, FC, ICC/IF, IP, WB |
| Reactivities | Human, Canine |
| Conjugation | Unconjugated |
TA336462 is a replacement of TA320480.
Rabbit Polyclonal TLR2 Antibody
| Applications | FC, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against a mixture of synthetic peptides containing amino acids 180-196, 353-370, and 473-489 of human TLR2 (NP_003255). |
Tlr2 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of mouse TLR2. |
TLR2 mouse monoclonal antibody, clone TL2.1, Biotin
| Applications | FC, IF, IHC, WB |
| Reactivities | Canine, Human, Monkey |
| Conjugation | Biotin |
Goat Polyclonal Anti-TLR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 736 aa to the C-terminus of human TLR2 produced in E. coli. |
TLR2 mouse monoclonal antibody, clone TL2.3, Purified
| Applications | ELISA, FC, FN, IF, IHC, WB |
| Reactivities | Canine, Human |
| Conjugation | Unconjugated |
AM26265PU-N is a replacement of TA320481.
Rabbit Polyclonal TLR2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against an extracellular domain of mouse TLR2 (amino acids 564-580 and 751-770). |
TLR2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TLR2 |
| Modifications | Unmodified |
Recombinant Anti-TLR2 (Clone TL2.1)
| Applications | Bl, FC, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- TLR2
Reactivities
- Human
Applications
- WB