Antibodies

View as table Download

Rabbit Polyclonal Anti-PLGLB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLGLB1 antibody is: synthetic peptide directed towards the middle region of Human PLGLB1. Synthetic peptide located within the following region: KKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENRKSSIIIR

Rabbit Polyclonal Anti-PLGLB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLGLB2 Antibody is: synthetic peptide directed towards the middle region of Human PLGLB2. Synthetic peptide located within the following region: PSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENR