Antibodies

View as table Download

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GUK1 mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI4A8 (formerly 4A8), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI4A8 (formerly 4A8), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Carrier-free (BSA/glycerol-free) GUK1 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-GUK1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GUK1

GUK1 (Guanylate Kinase 1) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-GUK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GUK1 Antibody: synthetic peptide directed towards the middle region of human GUK1. Synthetic peptide located within the following region: IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI

Rabbit Polyclonal Guanylate kinase Antibody

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Within the range of amino acids 128-166 of human GUK1 protein were used as the immunogen.