Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rat, Xenopus, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal anti-Gli-3 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Xenopus, Dog, Chimpanzee, Chicken, Quail |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
WNT3 (315-329) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat, Bovine, Bat, Chicken, Equine, Monkey, Porcine, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from an internal region of human WNT3 |
Rabbit Polyclonal Anti-SHH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Chicken |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT |
Rabbit polyclonal Beta TrCP2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Dog, Chicken, Bovine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminal of human βTrCP2 protein. |
Germany
Japan
United Kingdom
China
