Antibodies

View as table Download

Mouse Monoclonal Osteoprotegerin/TNFRSF11B Antibody (98A1071)

Applications CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Anti-TNFRSF11B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 195-365 amino acids of human tumor necrosis factor receptor superfamily, member 11b

TNFRSF11B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNFRSF11B

Rabbit polyclonal anti-TR11B antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TR11B.

Rabbit Polyclonal Anti-TNFRSF11B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF11B antibody: synthetic peptide directed towards the N terminal of human TNFRSF11B. Synthetic peptide located within the following region: LDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTV

Osteoprotegerin (TNFRSF11B) goat polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Purified recombinant Human Osteoprotegerin

Osteoprotegerin (TNFRSF11B) goat polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Purified recombinant Human Osteoprotegerin